PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10016143m
Common NameCICLE_v10016073mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 290aa    MW: 31901.2 Da    PI: 6.6712
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10016143mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.33.5e-333488155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWt +LH+rFv+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Ciclev10016143m 34 KPRLRWTADLHDRFVDAVTQLGGPSKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 88
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.2853191IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-313189IPR009057Homeodomain-like
SuperFamilySSF466892.87E-163488IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-243488IPR006447Myb domain, plants
PfamPF002492.8E-73687IPR001005SANT/Myb domain
PfamPF143793.4E-16115159IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MIQREEIINR TSYHYHQNHG GGIEPCVVMT SDPKPRLRWT ADLHDRFVDA VTQLGGPSKA  60
TPKAIMRTMN VKGLTLFHLK SHLQKYRLAS YLIESSANDN SPPNFPASDM NESYEVKEAL  120
RVQMEVQSKL HLQVEAEKHL QIRQNAQQRY LAMLERACKI LTDQILGGAV VDADSEKCKG  180
LGTKMPRSYI LDSLGFYTSQ SVEVAEVQCP EELLPNLHPQ RADCSTESCL TSHESSGGLT  240
MEGSPVGGKN SILSLDTTTG SLIWGEVKMG AQEISLARVN PSGISSYGI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.65471e-156fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006449967.10.0hypothetical protein CICLE_v10016073mg
TrEMBLV4UB240.0V4UB24_9R
STRINGGLYMA15G12930.11e-131(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.15e-58G2-like family protein